Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL2RB Rabbit Polyclonal Antibody (HRP)

IL2RB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD122, IMD63, IL15RB, P70-75

UniProt

P14784

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_000869

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHA Rabbit Monoclonal Antibody [Clone ID: R09-5K6]
TA385220 100 µL

SDHA Rabbit Monoclonal Antibody [Clone ID: R09-5K6]

Sign In for Pricing
View Details
C9orf95 (NMRK1) Human Gene Knockout Kit (CRISPR)
KN400160 1 Kit

C9orf95 (NMRK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM132A Human Gene Knockout Kit (CRISPR)
KN214846RB 1 Kit

TMEM132A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOXP2 Rabbit Polyclonal Antibody
TA366801 100 µL

FOXP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human EFTUD1 (EFL1) activation kit by CRISPRa
GA112503 1 Kit

Human EFTUD1 (EFL1) activation kit by CRISPRa

Sign In for Pricing
View Details
alpha Synuclein (SNCA) (NM_001146054) Human Over-expression Lysate
LC431763 20 µg

alpha Synuclein (SNCA) (NM_001146054) Human Over-expression Lysate

Sign In for Pricing
View Details