Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GET4 Rabbit Polyclonal Antibody (Biotin)

GET4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CEE, TRC35, CGI-20, C7orf20

UniProt

Q7L5D6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GET4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIEL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG3, F(ab)'2 (FITC)
MBS6261711-01 0.1 mL

IgG3, F(ab)'2 (FITC)

Sign In for Pricing
View Details
IgG3, F(ab)'2 (FITC)
MBS6261711-02 5x 0.1 mL

IgG3, F(ab)'2 (FITC)

Sign In for Pricing
View Details
Harm.Ph. Sabouraud Dextrose with Chloramphenicol and Cyklohexymide 5 ml x 50 Slanted Tubes
TMB_SABCC_TBC5_50 5 mL x 50 Slanted Tubes

Harm.Ph. Sabouraud Dextrose with Chloramphenicol and Cyklohexymide 5 ml x 50 Slanted Tubes

Sign In for Pricing
View Details
LOX 1 Rabbit Polyclonal Antibody (AP)
orb906253 100 µL

LOX 1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
IL-4I1 Polyclonal Antibody Cy3 Conjugated
MBS9461772-01 0.1 mL

IL-4I1 Polyclonal Antibody Cy3 Conjugated

Sign In for Pricing
View Details
IL-4I1 Polyclonal Antibody Cy3 Conjugated
MBS9461772-02 5x 0.1 mL

IL-4I1 Polyclonal Antibody Cy3 Conjugated

Sign In for Pricing
View Details