Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VASP Rabbit Polyclonal Antibody (FITC)

VASP Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P50552

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human VASP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSE

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003361

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD302 Antibody
orb685071 100 µL

CD302 Antibody

Sign In for Pricing
View Details
Histone H3 (Di Methyl K36) Rabbit Polyclonal Antibody (BF350)
orb1582458 100 µL

Histone H3 (Di Methyl K36) Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
His Buffer Kit
11003400 1 Each

His Buffer Kit

Sign In for Pricing
View Details
TIMM8A (Translocase of inner Mitochondrial Membrane 8 Homolog A (yeast), DDP, DDP1, DFN1, MGC12262, MTS) (MaxLight 750)
MBS6241016-01 0.1 mL

TIMM8A (Translocase of inner Mitochondrial Membrane 8 Homolog A (yeast), DDP, DDP1, DFN1, MGC12262, MTS) (MaxLight 750)

Sign In for Pricing
View Details
TIMM8A (Translocase of inner Mitochondrial Membrane 8 Homolog A (yeast), DDP, DDP1, DFN1, MGC12262, MTS) (MaxLight 750)
MBS6241016-02 5x 0.1 mL

TIMM8A (Translocase of inner Mitochondrial Membrane 8 Homolog A (yeast), DDP, DDP1, DFN1, MGC12262, MTS) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Petrotoga mobilis Glutamate--tRNA ligase 2 (gltX2)
MBS1121848-01 0.02 mg (E-Coli)

Recombinant Petrotoga mobilis Glutamate--tRNA ligase 2 (gltX2)

Sign In for Pricing
View Details