Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VASP Rabbit Polyclonal Antibody (Biotin)

VASP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P50552

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human VASP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGP

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_003361

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-EIF4EBP1 (Ser100) Rabbit pAb, AE conjugated
orb2843560 100 µL

Phospho-EIF4EBP1 (Ser100) Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Chicken Growth Stimulation expressed gene 2 (sST2) ELISA Kit
MBS2612269-01 48 Well

Chicken Growth Stimulation expressed gene 2 (sST2) ELISA Kit

Sign In for Pricing
View Details
Chicken Growth Stimulation expressed gene 2 (sST2) ELISA Kit
MBS2612269-02 96 Well

Chicken Growth Stimulation expressed gene 2 (sST2) ELISA Kit

Sign In for Pricing
View Details
Chicken Growth Stimulation expressed gene 2 (sST2) ELISA Kit
MBS2612269-03 5x 96 Well

Chicken Growth Stimulation expressed gene 2 (sST2) ELISA Kit

Sign In for Pricing
View Details
Chicken Growth Stimulation expressed gene 2 (sST2) ELISA Kit
MBS2612269-04 10x 96 Well

Chicken Growth Stimulation expressed gene 2 (sST2) ELISA Kit

Sign In for Pricing
View Details
Thioridazine EP Impurity A
CS-EO-00405 1 Each

Thioridazine EP Impurity A

Sign In for Pricing
View Details