Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT36 Rabbit Polyclonal Antibody (Biotin)

KRT36 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HA6, hHa6, KRTHA6

UniProt

O76013

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KRT36

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IEDFQQKILLTKSENARLVLQIDNAKLAADDFRTKYETELSLRQLVEADI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003762

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-137-5p miRNA Agomir
orb1916634-01 5 nmol

Rno-miR-137-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-137-5p miRNA Agomir
orb1916634-02 10 nmol

Rno-miR-137-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-137-5p miRNA Agomir
orb1916634-03 20 nmol

Rno-miR-137-5p miRNA Agomir

Sign In for Pricing
View Details
Polyclonal Antibody to High Mobility Group AT Hook Protein 2 (HMGA2)
MBS2006806-01 0.1 mL

Polyclonal Antibody to High Mobility Group AT Hook Protein 2 (HMGA2)

Sign In for Pricing
View Details
Polyclonal Antibody to High Mobility Group AT Hook Protein 2 (HMGA2)
MBS2006806-02 0.2 mL

Polyclonal Antibody to High Mobility Group AT Hook Protein 2 (HMGA2)

Sign In for Pricing
View Details
Polyclonal Antibody to High Mobility Group AT Hook Protein 2 (HMGA2)
MBS2006806-03 0.5 mL

Polyclonal Antibody to High Mobility Group AT Hook Protein 2 (HMGA2)

Sign In for Pricing
View Details