Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY96 Rabbit Polyclonal Antibody (HRP)

LY96 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MD2, MD-2, ly-96, ESOP-1

UniProt

Q9Y6Y9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056179

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCILOGEX SCI-RL-E Analog Rotisserie Tube Rotator, with 36 x 1.5ml & 12ea 15/50ml centrifuge tube clamps, 100-220V, 50/60Hz, US Plug
824220019999-01 1 Each

SCILOGEX SCI-RL-E Analog Rotisserie Tube Rotator, with 36 x 1.5ml & 12ea 15/50ml centrifuge tube clamps, 100-220V, 50/60Hz, US Plug

Sign In for Pricing
View Details
TAT226 (Genentech patent TAT226) discontinued
048602 100 µg

TAT226 (Genentech patent TAT226) discontinued

Sign In for Pricing
View Details
CATSPER1 siRNA (Human)
MBS8211024-01 15 nmol

CATSPER1 siRNA (Human)

Sign In for Pricing
View Details
CATSPER1 siRNA (Human)
MBS8211024-02 30 nmol

CATSPER1 siRNA (Human)

Sign In for Pricing
View Details
CATSPER1 siRNA (Human)
MBS8211024-03 5x 30 nmol

CATSPER1 siRNA (Human)

Sign In for Pricing
View Details
Lysyl-[Hyp3]-Bradykinin, human
PBK-4191-V 0.5 mg

Lysyl-[Hyp3]-Bradykinin, human

Sign In for Pricing
View Details