Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRAK2 Rabbit Polyclonal Antibody (Biotin)

IRAK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IRAK-2

UniProt

O43187

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human IRAK2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSSEACVGLEPPQDVTETSWQIEINEAKRKLMENILLYKEEKVDSIELFG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OSBPL3 Knockout A549 cell line
GTR15418838 1 Vial

Human OSBPL3 Knockout A549 cell line

Sign In for Pricing
View Details
Recombinant CREB-1 Monoclonal Antibody
AN300865L-01 50 µL

Recombinant CREB-1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CREB-1 Monoclonal Antibody
AN300865L-02 100 µL

Recombinant CREB-1 Monoclonal Antibody

Sign In for Pricing
View Details
CD69, ID (CD69, CLEC2C, Early activation antigen CD69, Activation inducer molecule, BL-AC/P26, C-type lectin domain family 2 member C, EA1, Early T-cell activation antigen p60, GP32/28, Leukocyte surface antigen Leu-23, MLR-3, CD69) (MaxLight 405)
MBS6283384-01 0.1 mL

CD69, ID (CD69, CLEC2C, Early activation antigen CD69, Activation inducer molecule, BL-AC/P26, C-type lectin domain family 2 member C, EA1, Early T-cell activation antigen p60, GP32/28, Leukocyte surface antigen Leu-23, MLR-3, CD69) (MaxLight 405)

Sign In for Pricing
View Details
CD69, ID (CD69, CLEC2C, Early activation antigen CD69, Activation inducer molecule, BL-AC/P26, C-type lectin domain family 2 member C, EA1, Early T-cell activation antigen p60, GP32/28, Leukocyte surface antigen Leu-23, MLR-3, CD69) (MaxLight 405)
MBS6283384-02 5x 0.1 mL

CD69, ID (CD69, CLEC2C, Early activation antigen CD69, Activation inducer molecule, BL-AC/P26, C-type lectin domain family 2 member C, EA1, Early T-cell activation antigen p60, GP32/28, Leukocyte surface antigen Leu-23, MLR-3, CD69) (MaxLight 405)

Sign In for Pricing
View Details
CD31/PECAM1  polyclonal antibody
BS79553 50ul

CD31/PECAM1 polyclonal antibody

Sign In for Pricing
View Details