Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRAK2 Rabbit Polyclonal Antibody (FITC)

IRAK2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IRAK-2

UniProt

O43187

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human IRAK2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSSEACVGLEPPQDVTETSWQIEINEAKRKLMENILLYKEEKVDSIELFG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001561

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anserini C4BPa ELISA Kit
EAC0882 96 Tests

Anserini C4BPa ELISA Kit

Sign In for Pricing
View Details
PHF11 Antibody
OAAN03730-100UL 100 µL

PHF11 Antibody

Sign In for Pricing
View Details
Anti-UBXN1 Rabbit pAb
GB112733-50 50 μL

Anti-UBXN1 Rabbit pAb

Sign In for Pricing
View Details
FABP2 Protein Vector (Rat) (pPB-C-His)
PV266974 500 ng

FABP2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
RNA Polymerases I and III Subunit AC1, CT (DNA-directed RNA Polymerases I And III Subunit RPAC1, POLR1C, DNA-directed RNA Polymerase I Subunit C, DNA-directed RNA Polymerases I And III 40kD Polypeptide, RPA40, RPC40, AC40, RPA39, POLR1E) (Biotin)
MBS6498062-01 0.2 mL

RNA Polymerases I and III Subunit AC1, CT (DNA-directed RNA Polymerases I And III Subunit RPAC1, POLR1C, DNA-directed RNA Polymerase I Subunit C, DNA-directed RNA Polymerases I And III 40kD Polypeptide, RPA40, RPC40, AC40, RPA39, POLR1E) (Biotin)

Sign In for Pricing
View Details
RNA Polymerases I and III Subunit AC1, CT (DNA-directed RNA Polymerases I And III Subunit RPAC1, POLR1C, DNA-directed RNA Polymerase I Subunit C, DNA-directed RNA Polymerases I And III 40kD Polypeptide, RPA40, RPC40, AC40, RPA39, POLR1E) (Biotin)
MBS6498062-02 5x 0.2 mL

RNA Polymerases I and III Subunit AC1, CT (DNA-directed RNA Polymerases I And III Subunit RPAC1, POLR1C, DNA-directed RNA Polymerase I Subunit C, DNA-directed RNA Polymerases I And III 40kD Polypeptide, RPA40, RPC40, AC40, RPA39, POLR1E) (Biotin)

Sign In for Pricing
View Details