Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsp90aa1 Rabbit Polyclonal Antibody (Biotin)

Hsp90aa1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hs, Hsp, hsp4, 86kDa, 89kDa, Hsp89, Hsp90, Hspca, Hsp86-1, AL024080, AL024147

UniProt

P07901

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034610

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-ERN1-3xMyc-Neo Plasmid
PVT68815 2 µg

PCMV-ERN1-3xMyc-Neo Plasmid

Sign In for Pricing
View Details
LRRC41 Antibody
orb679323 100 µL

LRRC41 Antibody

Sign In for Pricing
View Details
SMPD4 Protein Vector (Rat) (pPM-C-His)
PV306861 500 ng

SMPD4 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Alkaliphilus metalliredigens Ribosome maturation factor RimM (rimM)
MBS1233857-01 0.02 mg (E-Coli)

Recombinant Alkaliphilus metalliredigens Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Alkaliphilus metalliredigens Ribosome maturation factor RimM (rimM)
MBS1233857-02 0.1 mg (E-Coli)

Recombinant Alkaliphilus metalliredigens Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details
Recombinant Alkaliphilus metalliredigens Ribosome maturation factor RimM (rimM)
MBS1233857-03 0.02 mg (Yeast)

Recombinant Alkaliphilus metalliredigens Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details