Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsp90aa1 Rabbit Polyclonal Antibody (FITC)

Hsp90aa1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hs, Hsp, hsp4, 86kDa, 89kDa, Hsp89, Hsp90, Hspca, Hsp86-1, AL024080, AL024147

UniProt

P07901

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034610

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUT (NUTM1) (NM_001284292) Human Tagged ORF Clone
RG240011 10 µg

NUT (NUTM1) (NM_001284292) Human Tagged ORF Clone

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc, Multi-Species SP ads-BIOT
MBS679291-01 0.5 mg

Goat Anti-Human IgG Fc, Multi-Species SP ads-BIOT

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc, Multi-Species SP ads-BIOT
MBS679291-02 5x 0.5 mg

Goat Anti-Human IgG Fc, Multi-Species SP ads-BIOT

Sign In for Pricing
View Details
Isomalt 1g
A14329-1000 1000 mg

Isomalt 1g

Sign In for Pricing
View Details
Dipeptidyl Peptidase 9 (DPP9) Magnetic Luminex Assay Kit
LKU605460 96 Tests

Dipeptidyl Peptidase 9 (DPP9) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Rabbit Interleukin 1 Alpha (IL1a) ELISA Kit
RD-IL1a-Rb-01 96 Tests

Rabbit Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details