Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsp90aa1 Rabbit Polyclonal Antibody (HRP)

Hsp90aa1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hs, Hsp, hsp4, 86kDa, 89kDa, Hsp89, Hsp90, Hspca, Hsp86-1, AL024080, AL024147

UniProt

P07901

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034610

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleobindin 2 (NUCB2) (NM_005013) Human Recombinant Protein
TP320684L 1 mg

Nucleobindin 2 (NUCB2) (NM_005013) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701345 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Benzyl 2-Acetamido-2-deoxy-3-O-(b-D-galactopyranosyl) a-D-galactopyranoside
TRC-B212530-25MG 25 mg

Benzyl 2-Acetamido-2-deoxy-3-O-(b-D-galactopyranosyl) a-D-galactopyranoside

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS507166 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
PDPN (1-206) Mouse Monoclonal Antibody [Clone ID: 5E2]
AM03203PU-N 100 µL

PDPN (1-206) Mouse Monoclonal Antibody [Clone ID: 5E2]

Sign In for Pricing
View Details
Human POGLUT2 activation kit by CRISPRa
GA112345 1 Kit

Human POGLUT2 activation kit by CRISPRa

Sign In for Pricing
View Details