Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Asl Rabbit Polyclonal Antibody (HRP)

Asl Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASAL, 2510006M18Rik

UniProt

Q91YI0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_598529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS37D (NM_001077621) Human Over-expression Lysate
LC421464 20 µg

VPS37D (NM_001077621) Human Over-expression Lysate

Sign In for Pricing
View Details
MHC II (HLA-DP) (beta chain) (Bra-14), Biotin conjugate, 0.1mg/mL
BNCB1129-500 1x 500 µL

MHC II (HLA-DP) (beta chain) (Bra-14), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (BA17), 1mg/mL
BNUM0666-50 1x 50 µL

Cytokeratin 19 (BA17), 1mg/mL

Sign In for Pricing
View Details
Human ZNF 559 (ZNF559) activation kit by CRISPRa
GA113583 1 Kit

Human ZNF 559 (ZNF559) activation kit by CRISPRa

Sign In for Pricing
View Details
Secretogranin 3 (SCG3) (C-term) Rabbit Polyclonal Antibody
AP23363PU-N 100 µg

Secretogranin 3 (SCG3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome b Polyclonal Antibody
E-AB-13180-01 20 µL

Cytochrome b Polyclonal Antibody

Sign In for Pricing
View Details