Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCK Rabbit Polyclonal Antibody (Biotin)

HCK Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

JTK9, p59Hck, p61Hck

UniProt

P08631

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HCK

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001165602

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APS6-45
BA5790-10 10 mg

APS6-45

Sign In for Pricing
View Details
CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (MaxLight 405)
MBS6189678-01 0.1 mL

CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (MaxLight 405)

Sign In for Pricing
View Details
CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (MaxLight 405)
MBS6189678-02 5x 0.1 mL

CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Human NTF3/NGF2 Protein, N-His
orb2832627-01 20 µg

Recombinant Human NTF3/NGF2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NTF3/NGF2 Protein, N-His
orb2832627-02 50 µg

Recombinant Human NTF3/NGF2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NTF3/NGF2 Protein, N-His
orb2832627-03 100 µg

Recombinant Human NTF3/NGF2 Protein, N-His

Sign In for Pricing
View Details