Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCK Rabbit Polyclonal Antibody (HRP)

HCK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JTK9, p59Hck, p61Hck

UniProt

P08631

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HCK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001165602

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1559496 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6038202 1.0 µg DNA

RGD1559496 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
2- (Aminomethyl) -3H,4H,5H,7H,8H-pyrano[4,3-d]pyrimidin-4-one hydrochloride
UID71398-01 50 mg

2- (Aminomethyl) -3H,4H,5H,7H,8H-pyrano[4,3-d]pyrimidin-4-one hydrochloride

Sign In for Pricing
View Details
2- (Aminomethyl) -3H,4H,5H,7H,8H-pyrano[4,3-d]pyrimidin-4-one hydrochloride
UID71398-02 0.5 g

2- (Aminomethyl) -3H,4H,5H,7H,8H-pyrano[4,3-d]pyrimidin-4-one hydrochloride

Sign In for Pricing
View Details
RGD1563302 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV644542 1.0 µg DNA

RGD1563302 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Human PM20D1/N-Fatty-Acyl-Amino Acid Synthase/Hydrolase PM20D1 ELISA Kit
MBS2890540-01 48 Well

Human PM20D1/N-Fatty-Acyl-Amino Acid Synthase/Hydrolase PM20D1 ELISA Kit

Sign In for Pricing
View Details
Human PM20D1/N-Fatty-Acyl-Amino Acid Synthase/Hydrolase PM20D1 ELISA Kit
MBS2890540-02 96 Well

Human PM20D1/N-Fatty-Acyl-Amino Acid Synthase/Hydrolase PM20D1 ELISA Kit

Sign In for Pricing
View Details