Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Entpd1 Rabbit Polyclonal Antibody (FITC)

Entpd1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cd39, NTPDa, ectoa, AA408691, NTPDase-1, 2610206B08Rik, E130009M23Rik

UniProt

P55772

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKT

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033978

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLD1 Peptide - N-terminal region
MBS3245164-01 0.1 mg

POLD1 Peptide - N-terminal region

Sign In for Pricing
View Details
POLD1 Peptide - N-terminal region
MBS3245164-02 5x 0.1 mg

POLD1 Peptide - N-terminal region

Sign In for Pricing
View Details
CD99 (CD99 Antigen, 12E7, E2 Antigen, Protein MIC2, T-cell Surface Glycoprotein E2, MIC2, MIC2X, MIC2Y) (MaxLight 650)
MBS6373353-01 0.1 mL

CD99 (CD99 Antigen, 12E7, E2 Antigen, Protein MIC2, T-cell Surface Glycoprotein E2, MIC2, MIC2X, MIC2Y) (MaxLight 650)

Sign In for Pricing
View Details
CD99 (CD99 Antigen, 12E7, E2 Antigen, Protein MIC2, T-cell Surface Glycoprotein E2, MIC2, MIC2X, MIC2Y) (MaxLight 650)
MBS6373353-02 5x 0.1 mL

CD99 (CD99 Antigen, 12E7, E2 Antigen, Protein MIC2, T-cell Surface Glycoprotein E2, MIC2, MIC2X, MIC2Y) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Polyclonal Paralemmin 3 Antibody
NBP2-30739 0.1 mL

Rabbit Polyclonal Paralemmin 3 Antibody

Sign In for Pricing
View Details
1-10ml Pipette Plunger Cylinder Cap (09)
FLPFG306390501A 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

1-10ml Pipette Plunger Cylinder Cap (09)

Sign In for Pricing
View Details