Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Entpd1 Rabbit Polyclonal Antibody (FITC)

Entpd1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cd39, NTPDa, ectoa, AA408691, NTPDase-1, 2610206B08Rik, E130009M23Rik

UniProt

P55772

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKT

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033978

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Protein Kinase Inhibitor Alpha ELISA Kit
MBS744809-01 48 Well

Sheep Protein Kinase Inhibitor Alpha ELISA Kit

Sign In for Pricing
View Details
Sheep Protein Kinase Inhibitor Alpha ELISA Kit
MBS744809-02 96 Well

Sheep Protein Kinase Inhibitor Alpha ELISA Kit

Sign In for Pricing
View Details
Sheep Protein Kinase Inhibitor Alpha ELISA Kit
MBS744809-03 5x 96 Well

Sheep Protein Kinase Inhibitor Alpha ELISA Kit

Sign In for Pricing
View Details
Sheep Protein Kinase Inhibitor Alpha ELISA Kit
MBS744809-04 10x 96 Well

Sheep Protein Kinase Inhibitor Alpha ELISA Kit

Sign In for Pricing
View Details
CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (MaxLight 750) discontinued
244209-ML750 100 µL

CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SFRS14, CT (SUGP2, KIAA0365, SFRS14, SURP and G-patch domain-containing protein 2, Arginine/serine-rich-splicing factor 14, Splicing factor, arginine/serine-rich 14) (MaxLight 490)
MBS6346653-01 0.1 mL

SFRS14, CT (SUGP2, KIAA0365, SFRS14, SURP and G-patch domain-containing protein 2, Arginine/serine-rich-splicing factor 14, Splicing factor, arginine/serine-rich 14) (MaxLight 490)

Sign In for Pricing
View Details