Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUL3 Rabbit Polyclonal Antibody (FITC)

CUL3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CUL-3, PHA2E, NEDAUS

UniProt

Q13618

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CUL3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRI

Field of Research

Cancer Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7E62P Protein Vector (Human) (pPB-C-His)
PV108710 500 ng

OR7E62P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
IL22RA1 (Interleukin-22 Receptor Subunit alpha-1, IL-22 Receptor Subunit alpha-1, IL-22R-alpha-1, IL-22RA1, Cytokine Receptor Class-II Member 9, Cytokine Receptor Family 2 Member 9, CRF2-9, ZcytoR11, IL22R) (AP)
MBS6382739-01 0.1 mL

IL22RA1 (Interleukin-22 Receptor Subunit alpha-1, IL-22 Receptor Subunit alpha-1, IL-22R-alpha-1, IL-22RA1, Cytokine Receptor Class-II Member 9, Cytokine Receptor Family 2 Member 9, CRF2-9, ZcytoR11, IL22R) (AP)

Sign In for Pricing
View Details
IL22RA1 (Interleukin-22 Receptor Subunit alpha-1, IL-22 Receptor Subunit alpha-1, IL-22R-alpha-1, IL-22RA1, Cytokine Receptor Class-II Member 9, Cytokine Receptor Family 2 Member 9, CRF2-9, ZcytoR11, IL22R) (AP)
MBS6382739-02 5x 0.1 mL

IL22RA1 (Interleukin-22 Receptor Subunit alpha-1, IL-22 Receptor Subunit alpha-1, IL-22R-alpha-1, IL-22RA1, Cytokine Receptor Class-II Member 9, Cytokine Receptor Family 2 Member 9, CRF2-9, ZcytoR11, IL22R) (AP)

Sign In for Pricing
View Details
MMP-9 Cell-Based ELISA Kit
CB5467 1 Kit

MMP-9 Cell-Based ELISA Kit

Sign In for Pricing
View Details
CREB5 (Cyclic AMP-responsive Element-binding Protein 5, CREB-5, cAMP-responsive Element-binding Protein 5, CRE-BPa, CREBPA) (MaxLight 650)
MBS6374695-01 0.1 mL

CREB5 (Cyclic AMP-responsive Element-binding Protein 5, CREB-5, cAMP-responsive Element-binding Protein 5, CRE-BPa, CREBPA) (MaxLight 650)

Sign In for Pricing
View Details
CREB5 (Cyclic AMP-responsive Element-binding Protein 5, CREB-5, cAMP-responsive Element-binding Protein 5, CRE-BPa, CREBPA) (MaxLight 650)
MBS6374695-02 5x 0.1 mL

CREB5 (Cyclic AMP-responsive Element-binding Protein 5, CREB-5, cAMP-responsive Element-binding Protein 5, CRE-BPa, CREBPA) (MaxLight 650)

Sign In for Pricing
View Details