Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL16 Rabbit Polyclonal Antibody (HRP)

IL16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LCF, NIL16, PRIL16, prIL-16

UniProt

Q14005

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Goat, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_004504

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOHLH1 (NM_001012415) Human Over-expression Lysate
LC422853 20 µg

SOHLH1 (NM_001012415) Human Over-expression Lysate

Sign In for Pricing
View Details
Carboxypeptidase H (CPE) (NM_001873) Human Over-expression Lysate
LY419701 100 µg

Carboxypeptidase H (CPE) (NM_001873) Human Over-expression Lysate

Sign In for Pricing
View Details
Nucleophosmin (NPM1) (NM_001037738) Human Over-expression Lysate
LY421985 100 µg

Nucleophosmin (NPM1) (NM_001037738) Human Over-expression Lysate

Sign In for Pricing
View Details
Cryba4 (NM_021351) Mouse Tagged ORF Clone
MG201946 10 µg

Cryba4 (NM_021351) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/775), CF405S conjugate, 0.1mg/mL
BNC040775-100 1x 100 µL

Pgp9.5 (UCHL-1) (UCHL1/775), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A7]
TA803267AM 100 µL

Cytokeratin 14 (KRT14) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A7]

Sign In for Pricing
View Details