Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL16 Rabbit Polyclonal Antibody (HRP)

IL16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LCF, NIL16, PRIL16, prIL-16

UniProt

Q8IUU6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEAQSSNF

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

AAH40272

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monalizumab Biosimilar - Research Grade
ICH5017-50mg 50 mg

Monalizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Striatin (STRN) Human Gene Knockout Kit (CRISPR)
KN415098 1 Kit

Striatin (STRN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit
E-EL-M0800-01 24 Tests

Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit

Sign In for Pricing
View Details
Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit
E-EL-M0800-02 48 Tests

Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit

Sign In for Pricing
View Details
Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit
E-EL-M0800-03 96 Tests

Mouse MUC5B (Mucin-5 Subtype B) ELISA Kit

Sign In for Pricing
View Details
Mmp3 Mouse Gene Knockout Kit (CRISPR)
KN310182BN 1 Kit

Mmp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details