Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDO Rabbit Polyclonal Antibody (FITC)

DDO Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DASOX, DDO-1, DDO-2

UniProt

Q99489

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDO

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004023

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPAG11A, NT (SPAG11A, EP2, HE2, Sperm-associated antigen 11A, Human epididymis-specific protein 2, Protein EP2, Sperm antigen HE2) (FITC)
MBS6350275-01 0.2 mL

SPAG11A, NT (SPAG11A, EP2, HE2, Sperm-associated antigen 11A, Human epididymis-specific protein 2, Protein EP2, Sperm antigen HE2) (FITC)

Sign In for Pricing
View Details
SPAG11A, NT (SPAG11A, EP2, HE2, Sperm-associated antigen 11A, Human epididymis-specific protein 2, Protein EP2, Sperm antigen HE2) (FITC)
MBS6350275-02 5x 0.2 mL

SPAG11A, NT (SPAG11A, EP2, HE2, Sperm-associated antigen 11A, Human epididymis-specific protein 2, Protein EP2, Sperm antigen HE2) (FITC)

Sign In for Pricing
View Details
Visceral Adipose Tissue Derived Serine Protease Inhibitor (Vaspin) Magnetic Fluorescence Assay Kit
MBS2156144-01 96 Tests

Visceral Adipose Tissue Derived Serine Protease Inhibitor (Vaspin) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Visceral Adipose Tissue Derived Serine Protease Inhibitor (Vaspin) Magnetic Fluorescence Assay Kit
MBS2156144-02 5x 96 Tests

Visceral Adipose Tissue Derived Serine Protease Inhibitor (Vaspin) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Visceral Adipose Tissue Derived Serine Protease Inhibitor (Vaspin) Magnetic Fluorescence Assay Kit
MBS2156144-03 10x 96 Tests

Visceral Adipose Tissue Derived Serine Protease Inhibitor (Vaspin) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
SBP-2 HDR Plasmid (h)
sc-409577-HDR 20 µg

SBP-2 HDR Plasmid (h)

Sign In for Pricing
View Details