Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDO Rabbit Polyclonal Antibody (HRP)

DDO Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DASOX, DDO-1, DDO-2

UniProt

Q99489

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDO

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004023

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Purinergic Receptor P2Y, G Protein Coupled 12 (P2RY12) ELISA Kit
orb778249-01 48 Tests

Human Purinergic Receptor P2Y, G Protein Coupled 12 (P2RY12) ELISA Kit

Sign In for Pricing
View Details
Human Purinergic Receptor P2Y, G Protein Coupled 12 (P2RY12) ELISA Kit
orb778249-02 96 Tests

Human Purinergic Receptor P2Y, G Protein Coupled 12 (P2RY12) ELISA Kit

Sign In for Pricing
View Details
PTEN, phosphorylated (Y315) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (Azide free) (HRP) discontinued
040618-HRP 200 µL

PTEN, phosphorylated (Y315) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Synapsin antibody
20R-2099 0.05 mg

Synapsin antibody

Sign In for Pricing
View Details
pCDH-CMV-WDR43-3×FLAG-EF1a-CopGFP-T2A-Puro-WPRE Plasmid
PVT36896 2 µg

pCDH-CMV-WDR43-3×FLAG-EF1a-CopGFP-T2A-Puro-WPRE Plasmid

Sign In for Pricing
View Details
Cytokeratin 10 (BCIE, BIE, EHK, Keratin Type I Cytoskeletal 10, KRT10) (BSA & Azide Free)
172072-AF 100 µg

Cytokeratin 10 (BCIE, BIE, EHK, Keratin Type I Cytoskeletal 10, KRT10) (BSA & Azide Free)

Sign In for Pricing
View Details