Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rcc1 Rabbit Polyclonal Antibody (Biotin)

Rcc1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Chc1, AI326872, 4931417M11Rik

UniProt

Q6PFB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALVPLLQDVVQAEAGGMHTVCLSQSGQVYSFGCNDEGALGRDTSVEGSEM

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001184011

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Calcium and integrin binding family member 2 (CIB2) ELISA Kit
MBS7230114-01 48 Well

Human Calcium and integrin binding family member 2 (CIB2) ELISA Kit

Sign In for Pricing
View Details
Human Calcium and integrin binding family member 2 (CIB2) ELISA Kit
MBS7230114-02 96 Well

Human Calcium and integrin binding family member 2 (CIB2) ELISA Kit

Sign In for Pricing
View Details
Human Calcium and integrin binding family member 2 (CIB2) ELISA Kit
MBS7230114-03 5x 96 Well

Human Calcium and integrin binding family member 2 (CIB2) ELISA Kit

Sign In for Pricing
View Details
Human Calcium and integrin binding family member 2 (CIB2) ELISA Kit
MBS7230114-04 10x 96 Well

Human Calcium and integrin binding family member 2 (CIB2) ELISA Kit

Sign In for Pricing
View Details
CHAC2 Blocking Peptide
33R-6622 0.1 mg

CHAC2 Blocking Peptide

Sign In for Pricing
View Details
CHEK2 Protein Vector (Mouse) (pPB-N-His)
PV165191 500 ng

CHEK2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details