Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECTIN1 Rabbit Polyclonal Antibody (FITC)

NECTIN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ED4, PRR, HIgR, HV1S, HVEC, OFC7, PRR1, PVRR, CD111, PVRL1, PVRR1, SK-12, CLPED1, nectin-1

UniProt

Q15223

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLNLTVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWE

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002846

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4G2 Antibody
8C13062-AAT 50 µg

EIF4G2 Antibody

Sign In for Pricing
View Details
Rat Clara cell protein, CC16 ELISA Kit
YLA0968RA-01 48 Tests

Rat Clara cell protein, CC16 ELISA Kit

Sign In for Pricing
View Details
Rat Clara cell protein, CC16 ELISA Kit
YLA0968RA-02 96 Tests

Rat Clara cell protein, CC16 ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycoplasma Pneumoniae MPN_650 Protein (aa 20-101)
VAng-Lsx05081-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Pneumoniae MPN_650 Protein (aa 20-101)

Sign In for Pricing
View Details
G-protein coupled Receptor 124 (GPR124) Human ELISA Kit
D5522 96 Tests

G-protein coupled Receptor 124 (GPR124) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit Brucella Abbortus IgG Antibody (Brucella Abbortus IgG Ab) ELISA Kit
EIA07281Rb 1 Kit

Rabbit Brucella Abbortus IgG Antibody (Brucella Abbortus IgG Ab) ELISA Kit

Sign In for Pricing
View Details