Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RACK1 Rabbit Polyclonal Antibody (Biotin)

RACK1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P20, Gnb2, p205, GB-li, Gnb2-, Gnb2l1, GB-like, AL033335, Gnb2-rs1

UniProt

P68040

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBAP1 Protein Lysate
OCOA21156-20UG 20 µg

UBAP1 Protein Lysate

Sign In for Pricing
View Details
Recombinant Cytokeratin 8 Antibody / KRT8 / CK18
V8648-20UG 20 µg

Recombinant Cytokeratin 8 Antibody / KRT8 / CK18

Sign In for Pricing
View Details
ARL5B Protein Vector (Rat) (pPM-C-HA)
12395026 500 ng

ARL5B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
VASA Recombinant Protein Antigen
NBP2-13908PEP 0.1 mL

VASA Recombinant Protein Antigen

Sign In for Pricing
View Details
Human RFTN1 / Raftlin Recombinant Protein
R7709h 1 Each

Human RFTN1 / Raftlin Recombinant Protein

Sign In for Pricing
View Details
Rat Chrnb2 Pre-designed siRNA Set B
SI202738B 1 Each

Rat Chrnb2 Pre-designed siRNA Set B

Sign In for Pricing
View Details