Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBA Rabbit Polyclonal Antibody (Biotin)

GBA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GCB, GBA1, GLUC

UniProt

P04062

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GLCM

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSS

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_006711333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Immortalized Human Coronary Artery Smooth Muscle Cells
T0557 1x106 cells / 1.0 mL

Immortalized Human Coronary Artery Smooth Muscle Cells

Sign In for Pricing
View Details
Anti-SLC30A8 Polyclonal Antibody
HV761014-01 50 µg

Anti-SLC30A8 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SLC30A8 Polyclonal Antibody
HV761014-02 100 µg

Anti-SLC30A8 Polyclonal Antibody

Sign In for Pricing
View Details
GGT1, NT (GGT1, GGT, Gamma-glutamyltranspeptidase 1, Gamma-glutamyltransferase 1, Glutathione hydrolase 1, Leukotriene-C4 hydrolase, CD224, Gamma-glutamyltranspeptidase 1 heavy chain, Gamma-glutamyltranspeptidase 1 light chain) (MaxLight 490)
MBS6302144-01 0.1 mL

GGT1, NT (GGT1, GGT, Gamma-glutamyltranspeptidase 1, Gamma-glutamyltransferase 1, Glutathione hydrolase 1, Leukotriene-C4 hydrolase, CD224, Gamma-glutamyltranspeptidase 1 heavy chain, Gamma-glutamyltranspeptidase 1 light chain) (MaxLight 490)

Sign In for Pricing
View Details
GGT1, NT (GGT1, GGT, Gamma-glutamyltranspeptidase 1, Gamma-glutamyltransferase 1, Glutathione hydrolase 1, Leukotriene-C4 hydrolase, CD224, Gamma-glutamyltranspeptidase 1 heavy chain, Gamma-glutamyltranspeptidase 1 light chain) (MaxLight 490)
MBS6302144-02 5x 0.1 mL

GGT1, NT (GGT1, GGT, Gamma-glutamyltranspeptidase 1, Gamma-glutamyltransferase 1, Glutathione hydrolase 1, Leukotriene-C4 hydrolase, CD224, Gamma-glutamyltranspeptidase 1 heavy chain, Gamma-glutamyltranspeptidase 1 light chain) (MaxLight 490)

Sign In for Pricing
View Details
EPM2A (Epilepsy, Progressive Myoclonus Type 2A, Lafora Disease (laforin), EPM2, MELF) (MaxLight 550)
MBS6216729-01 0.1 mL

EPM2A (Epilepsy, Progressive Myoclonus Type 2A, Lafora Disease (laforin), EPM2, MELF) (MaxLight 550)

Sign In for Pricing
View Details