Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP3 Rabbit Polyclonal Antibody (Biotin)

TNFAIP3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A20, AISBL, OTUD7C, TNFA1P2

UniProt

P21580

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

IHC

NCBI Accession Number

NP_006281

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC688657 3'UTR Luciferase Stable Cell Line
TU211755 1.0 mL

LOC688657 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monkey FcgammaR II/CD32 (Receptor II for the Fc Fragment of IgG) ELISA Kit
MBS2502401-01 24 Tests

Monkey FcgammaR II/CD32 (Receptor II for the Fc Fragment of IgG) ELISA Kit

Sign In for Pricing
View Details
Monkey FcgammaR II/CD32 (Receptor II for the Fc Fragment of IgG) ELISA Kit
MBS2502401-02 48 Tests

Monkey FcgammaR II/CD32 (Receptor II for the Fc Fragment of IgG) ELISA Kit

Sign In for Pricing
View Details
Monkey FcgammaR II/CD32 (Receptor II for the Fc Fragment of IgG) ELISA Kit
MBS2502401-03 96 Tests

Monkey FcgammaR II/CD32 (Receptor II for the Fc Fragment of IgG) ELISA Kit

Sign In for Pricing
View Details
Monkey FcgammaR II/CD32 (Receptor II for the Fc Fragment of IgG) ELISA Kit
MBS2502401-04 5x 96 Tests

Monkey FcgammaR II/CD32 (Receptor II for the Fc Fragment of IgG) ELISA Kit

Sign In for Pricing
View Details
Monkey FcgammaR II/CD32 (Receptor II for the Fc Fragment of IgG) ELISA Kit
MBS2502401-05 10x 96 Tests

Monkey FcgammaR II/CD32 (Receptor II for the Fc Fragment of IgG) ELISA Kit

Sign In for Pricing
View Details