Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4b Rabbit Polyclonal Antibody (Biotin)

Eif4b Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C85189, Eif4a2, AL024095, 2310046H11Rik

UniProt

Q922K6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Eif4b

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAH07171

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inositol polyphosphate 5-Phosphatase K (INPP5K) Human ELISA Kit
E2753 96 Tests

Inositol polyphosphate 5-Phosphatase K (INPP5K) Human ELISA Kit

Sign In for Pricing
View Details
SABC(mouse/rabbit IgG)
SA2010 1kit

SABC(mouse/rabbit IgG)

Sign In for Pricing
View Details
C19orf51 (Dynein Assembly Factor 3, axonemal, DNAAF3, C19orf51) (Biotin) discontinued
302306-Biotin 200 µL

C19orf51 (Dynein Assembly Factor 3, axonemal, DNAAF3, C19orf51) (Biotin) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Impdh1 shRNA (UAS) - Lentiviral mouse Impdh1 shRNA (UAS, iRFP) (25)
GTR15143426 1 Vial

Lentiviral mouse Impdh1 shRNA (UAS) - Lentiviral mouse Impdh1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
E4F1 shRNA (m) Lentiviral Particles
sc-143261-V 200 µL

E4F1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
PSMA4 (Proteasome Subunit alpha Type-4, Proteasome Component C9, Macropain Subunit C9, Multicatalytic Endopeptidase Complex Subunit C9, Proteasome Subunit L, PSC9, HC9, MGC111191, MGC12467, MGC24813)
131942 100 µg

PSMA4 (Proteasome Subunit alpha Type-4, Proteasome Component C9, Macropain Subunit C9, Multicatalytic Endopeptidase Complex Subunit C9, Proteasome Subunit L, PSC9, HC9, MGC111191, MGC12467, MGC24813)

Sign In for Pricing
View Details