Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFZ Rabbit Polyclonal Antibody (Biotin)

H2AFZ Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H2AZ, H2A.z, H2A/z, H2AFZ, H2A.Z-1

UniProt

P0C0S5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002097

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLXPL rabbit pAb
ES14932-01 50 µL

MLXPL rabbit pAb

Sign In for Pricing
View Details
MLXPL rabbit pAb
ES14932-02 100 µL

MLXPL rabbit pAb

Sign In for Pricing
View Details
HA/Hemagglutinin, H6N4 (CAC84244, sf9, His)
HY-P77031 1 Each

HA/Hemagglutinin, H6N4 (CAC84244, sf9, His)

Sign In for Pricing
View Details
Human RIMKLA Knockout A549 cell line
GTR15413748 1 Vial

Human RIMKLA Knockout A549 cell line

Sign In for Pricing
View Details
WARS2 (Tryptophan--tRNA Ligase, Mitochondrial, (Mt)TrpRS, Tryptophanyl-tRNA Synthetase, TrpRS) (MaxLight 750)
MBS6398467-01 0.1 mL

WARS2 (Tryptophan--tRNA Ligase, Mitochondrial, (Mt)TrpRS, Tryptophanyl-tRNA Synthetase, TrpRS) (MaxLight 750)

Sign In for Pricing
View Details
WARS2 (Tryptophan--tRNA Ligase, Mitochondrial, (Mt)TrpRS, Tryptophanyl-tRNA Synthetase, TrpRS) (MaxLight 750)
MBS6398467-02 5x 0.1 mL

WARS2 (Tryptophan--tRNA Ligase, Mitochondrial, (Mt)TrpRS, Tryptophanyl-tRNA Synthetase, TrpRS) (MaxLight 750)

Sign In for Pricing
View Details