Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD244 Rabbit Polyclonal Antibody (HRP)

CD244 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2B4, NAIL, Nmrk, NKR2B4, SLAMF4

UniProt

B2R820

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_057466

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WISP-2 Lentiviral Activation Particles (m2)
sc-423706-LAC-2 200 µL

WISP-2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Tp53 Polyclonal Antibody, FITC Conjugated
A52072-100 100 µL

Tp53 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Human IL31RA (Interleukin-31 receptor subunit alpha) ELISA Kit
ELK11350-01 48 Tests

Human IL31RA (Interleukin-31 receptor subunit alpha) ELISA Kit

Sign In for Pricing
View Details
Human IL31RA (Interleukin-31 receptor subunit alpha) ELISA Kit
ELK11350-02 96 Tests

Human IL31RA (Interleukin-31 receptor subunit alpha) ELISA Kit

Sign In for Pricing
View Details
Human IL31RA (Interleukin-31 receptor subunit alpha) ELISA Kit
ELK11350-03 5x 96 Tests

Human IL31RA (Interleukin-31 receptor subunit alpha) ELISA Kit

Sign In for Pricing
View Details
P17 Treponema Pallidum protein (HRP)
65-IT66 1 mL

P17 Treponema Pallidum protein (HRP)

Sign In for Pricing
View Details