Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCRC1 Rabbit Polyclonal Antibody (Biotin)

UQCRC1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

QCR1, UQCR1, D3S3191

UniProt

P31930

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYI

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003356

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF-1 / NKX2.1 (NX2.1/690), 1mg/mL
BNUM0690-50 1x 50 µL

TTF-1 / NKX2.1 (NX2.1/690), 1mg/mL

Sign In for Pricing
View Details
Nisin A, Technical grade (~2.5% mainly sodium chloride and denatured milk solids)
TRC-N487550-5G 5 g

Nisin A, Technical grade (~2.5% mainly sodium chloride and denatured milk solids)

Sign In for Pricing
View Details
Mini Sample Mouse IL-1ra/IL-1F3 (Interleukin 1 Receptor Antagonist) ELISA Kit
E-MSEL-M0058-01 24 Tests

Mini Sample Mouse IL-1ra/IL-1F3 (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse IL-1ra/IL-1F3 (Interleukin 1 Receptor Antagonist) ELISA Kit
E-MSEL-M0058-02 48 Tests

Mini Sample Mouse IL-1ra/IL-1F3 (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse IL-1ra/IL-1F3 (Interleukin 1 Receptor Antagonist) ELISA Kit
E-MSEL-M0058-03 96 Tests

Mini Sample Mouse IL-1ra/IL-1F3 (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
Human FAM120AOS activation kit by CRISPRa
GA115953 1 Kit

Human FAM120AOS activation kit by CRISPRa

Sign In for Pricing
View Details