Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF6 Rabbit Polyclonal Antibody (FITC)

EIF6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CAB, EIF3A, eIF-6, p27BBP, ITGB4BP, b (2) gcn, p27 (BBP)

UniProt

P56537

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002203

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCR alpha, beta (FLJ22602, MGC117436, MGC22624, MGC23964, MGC71411, T cell antigen Receptor alpha Polypeptide, T cell antigen Receptor betaPolypeptide, T cell antigen Receptor beta Polypeptide T cell Receptor beta cluster, T cellReceptor alpha, T cell Receptor alpha chain, T cell Receptor alpha chain C region, Tcell Receptor alpha chain V region CTL L17, T cell Receptor alpha constant, T cell Receptor alphalocus, T cell Receptor beta chain, T cell Receptor beta chain V region CTL L17, T cellReceptor beta cluster, T cell Receptor beta locus, TCRA, TCRB, TCRD, TRA, TRA@, TRAC, TRB, TRB@, TRDD 3, TRDD3)
254305 100 µL

TCR alpha, beta (FLJ22602, MGC117436, MGC22624, MGC23964, MGC71411, T cell antigen Receptor alpha Polypeptide, T cell antigen Receptor betaPolypeptide, T cell antigen Receptor beta Polypeptide T cell Receptor beta cluster, T cellReceptor alpha, T cell Receptor alpha chain, T cell Receptor alpha chain C region, Tcell Receptor alpha chain V region CTL L17, T cell Receptor alpha constant, T cell Receptor alphalocus, T cell Receptor beta chain, T cell Receptor beta chain V region CTL L17, T cellReceptor beta cluster, T cell Receptor beta locus, TCRA, TCRB, TCRD, TRA, TRA@, TRAC, TRB, TRB@, TRDD 3, TRDD3)

Sign In for Pricing
View Details
Anti-CHIKV p130/Structural polyprotein Antibody (DC2.550B)
RVV09610 100 μg

Anti-CHIKV p130/Structural polyprotein Antibody (DC2.550B)

Sign In for Pricing
View Details
Canine Adenovirus Type 2 Native Antigen
OPEF01503-1MG 1 mg

Canine Adenovirus Type 2 Native Antigen

Sign In for Pricing
View Details
FAM24B Human Over-expression Lysate
orb1376271 20 µg

FAM24B Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-Flt3/CD135 (Tyr591) Antibody
MBS9614153-01 0.05 mL

Phospho-Flt3/CD135 (Tyr591) Antibody

Sign In for Pricing
View Details
Phospho-Flt3/CD135 (Tyr591) Antibody
MBS9614153-02 0.1 mL

Phospho-Flt3/CD135 (Tyr591) Antibody

Sign In for Pricing
View Details