Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF6 Rabbit Polyclonal Antibody (Biotin)

EIF6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CAB, EIF3A, eIF-6, p27BBP, ITGB4BP, b (2) gcn, p27 (BBP)

UniProt

P56537

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002203

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RBM38 (RNA Binding Motif Protein 38) ELISA Kit
EK243470 96 Well

Human RBM38 (RNA Binding Motif Protein 38) ELISA Kit

Sign In for Pricing
View Details
TMEM169 Adenovirus (Rat)
46935056 1.0 mL

TMEM169 Adenovirus (Rat)

Sign In for Pricing
View Details
LAT (Linker for activation of T Cells) (PE)
MBS6244227-01 0.1 mL

LAT (Linker for activation of T Cells) (PE)

Sign In for Pricing
View Details
LAT (Linker for activation of T Cells) (PE)
MBS6244227-02 5x 0.1 mL

LAT (Linker for activation of T Cells) (PE)

Sign In for Pricing
View Details
Mouse anti-Uroplakin 3a Antibody
DL99511A-01 50 µL

Mouse anti-Uroplakin 3a Antibody

Sign In for Pricing
View Details
Mouse anti-Uroplakin 3a Antibody
DL99511A-02 100 µL

Mouse anti-Uroplakin 3a Antibody

Sign In for Pricing
View Details