Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWOX Rabbit Polyclonal Antibody (Biotin)

WWOX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FOR, WOX1, DEE28, EIEE28, FRA16D, SCAR12, HHCMA56, PRO0128, SDR41C1, D16S432E

UniProt

Q9NZC7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human WWOX

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERTAD1 (SERTA Domain-containing Protein 1, CDK4-binding Protein p34SEI1, SEI1, SEI-1, Transcriptional Regulator Interacting with the PHD-bromodomain 1, TRIP-Br1) (MaxLight 405)
MBS6192557-01 0.1 mL

SERTAD1 (SERTA Domain-containing Protein 1, CDK4-binding Protein p34SEI1, SEI1, SEI-1, Transcriptional Regulator Interacting with the PHD-bromodomain 1, TRIP-Br1) (MaxLight 405)

Sign In for Pricing
View Details
SERTAD1 (SERTA Domain-containing Protein 1, CDK4-binding Protein p34SEI1, SEI1, SEI-1, Transcriptional Regulator Interacting with the PHD-bromodomain 1, TRIP-Br1) (MaxLight 405)
MBS6192557-02 5x 0.1 mL

SERTAD1 (SERTA Domain-containing Protein 1, CDK4-binding Protein p34SEI1, SEI1, SEI-1, Transcriptional Regulator Interacting with the PHD-bromodomain 1, TRIP-Br1) (MaxLight 405)

Sign In for Pricing
View Details
Fut2 ORF Vector (Mouse) (pORF)
21078014 1.0 µg DNA

Fut2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ADAM30 CRISPR Activation Plasmid (m2)
sc-427873-ACT-2 20 µg

ADAM30 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Simian apoprotein B100, apo-B100 ELISA Kit
MBS9311300 Inquire

Simian apoprotein B100, apo-B100 ELISA Kit

Sign In for Pricing
View Details
Lipopolysaccharide Binding Protein (LBP) Polyclonal Antibody
CAU25990-01 100 µL

Lipopolysaccharide Binding Protein (LBP) Polyclonal Antibody

Sign In for Pricing
View Details