Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWOX Rabbit Polyclonal Antibody (FITC)

WWOX Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FOR, WOX1, DEE28, EIEE28, FRA16D, SCAR12, HHCMA56, PRO0128, SDR41C1, D16S432E

UniProt

Q9NZC7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_570607

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 pThr450 Rabbit Polyclonal Antibody
AP08031PU-N 100 µL

AKT1 pThr450 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ints10 (NM_001134416) Rat Tagged Lenti ORF Clone
RR200584L3 10 µg

Ints10 (NM_001134416) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-SMO-S615 pAb
E9P0937 100 µL

Phospho-SMO-S615 pAb

Sign In for Pricing
View Details
Recombinant Marchantia polymorpha Photosystem I reaction center subunit VIII (psaI), partial
MBS1113694-01 1 mg (E-Coli)

Recombinant Marchantia polymorpha Photosystem I reaction center subunit VIII (psaI), partial

Sign In for Pricing
View Details
Recombinant Marchantia polymorpha Photosystem I reaction center subunit VIII (psaI), partial
MBS1113694-02 1 mg (Yeast)

Recombinant Marchantia polymorpha Photosystem I reaction center subunit VIII (psaI), partial

Sign In for Pricing
View Details
Phospho-IRAK1 (Thr387) Blocking Peptide
MBS9618972-01 1 mg

Phospho-IRAK1 (Thr387) Blocking Peptide

Sign In for Pricing
View Details