Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWOX Rabbit Polyclonal Antibody (HRP)

WWOX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FOR, WOX1, DEE28, EIEE28, FRA16D, SCAR12, HHCMA56, PRO0128, SDR41C1, D16S432E

UniProt

Q9NZC7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_570607

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TWA1 Antibody [DyLight 405]
NBP1-77366V 0.1 mL

Rabbit Polyclonal TWA1 Antibody [DyLight 405]

Sign In for Pricing
View Details
CCBL1, Recombinant, Human, aa1-372, His-SUMO-Tag (Kynurenine--oxoglutarate Transaminase 1)
372612-01 20 µg

CCBL1, Recombinant, Human, aa1-372, His-SUMO-Tag (Kynurenine--oxoglutarate Transaminase 1)

Sign In for Pricing
View Details
CCBL1, Recombinant, Human, aa1-372, His-SUMO-Tag (Kynurenine--oxoglutarate Transaminase 1)
372612-02 100 µg

CCBL1, Recombinant, Human, aa1-372, His-SUMO-Tag (Kynurenine--oxoglutarate Transaminase 1)

Sign In for Pricing
View Details
CCBL1, Recombinant, Human, aa1-372, His-SUMO-Tag (Kynurenine--oxoglutarate Transaminase 1)
372612-03 1 mg

CCBL1, Recombinant, Human, aa1-372, His-SUMO-Tag (Kynurenine--oxoglutarate Transaminase 1)

Sign In for Pricing
View Details
GLT8D2 Antibody - C-terminal region
ARP49993_P050-25UL 25 µL

GLT8D2 Antibody - C-terminal region

Sign In for Pricing
View Details
PPP1R3B Rabbit pAb
E45R21485N-100 100 µL

PPP1R3B Rabbit pAb

Sign In for Pricing
View Details