Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dhh Rabbit Polyclonal Antibody (HRP)

Dhh Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C78960

UniProt

Q61488

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dhh

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031883

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butr1 sgRNA CRISPR Lentivector set (Mouse)
K3161701 3x 1.0 µg

Butr1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Genesig Real-Time PCR detection kit for Staphylococcus haemolyticus, Advanced
349451 1 Kit

Genesig Real-Time PCR detection kit for Staphylococcus haemolyticus, Advanced

Sign In for Pricing
View Details
Rat CORO1A (Coronin 1A) ELISA Kit
EK246067 96 Well

Rat CORO1A (Coronin 1A) ELISA Kit

Sign In for Pricing
View Details
Anti- Human CSF1R/Macrophage colony-stimulating factor 1 receptor
IT-300-123M6-01 0.1 mg

Anti- Human CSF1R/Macrophage colony-stimulating factor 1 receptor

Sign In for Pricing
View Details
Anti- Human CSF1R/Macrophage colony-stimulating factor 1 receptor
IT-300-123M6-02 0.5 mg

Anti- Human CSF1R/Macrophage colony-stimulating factor 1 receptor

Sign In for Pricing
View Details
SERBP1 siRNA (Rat)
orb1830274-01 15 nmol

SERBP1 siRNA (Rat)

Sign In for Pricing
View Details