Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABI2 Rabbit Polyclonal Antibody (Biotin)

ABI2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AIP1, ABI-2, ABI2B, AIP-1, AblBP3, argBP1, SSH3BP2, argBPIA, argBPIB

UniProt

Q9NYB9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ABI2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTT

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005750

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF20 Human Over-expression Lysate
orb1349821 100 µg

FGF20 Human Over-expression Lysate

Sign In for Pricing
View Details
TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (MaxLight 650)
MBS6225250-01 0.1 mL

TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (MaxLight 650)

Sign In for Pricing
View Details
TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (MaxLight 650)
MBS6225250-02 5x 0.1 mL

TSSK3 (Testis-specific Serine/threonine-protein Kinase 3, TSSK-3, Testis-specific Kinase 3, TSK3, TSK-3, Serine/threonine-protein Kinase 22C, STK22C, SPOGA3) (MaxLight 650)

Sign In for Pricing
View Details
DPAGT1 Protein Vector (Human) (pPB-N-His)
PV012966 500 ng

DPAGT1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L) - Texas Red
CSA2740-01 100 µL

Mouse Anti-Monkey IgG (H&L) - Texas Red

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L) - Texas Red
CSA2740-02 500 μL

Mouse Anti-Monkey IgG (H&L) - Texas Red

Sign In for Pricing
View Details