ABI2 Rabbit Polyclonal Antibody (Biotin)
ABI2 Rabbit Polyclonal Antibody (Biotin)
Product Specifications
Product Name Alternative
AIP1, ABI-2, ABI2B, AIP-1, AblBP3, argBP1, SSH3BP2, argBPIA, argBPIB
UniProt
Q9NYB9
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ABI2
Clonality
Polyclonal
Conjugation
Biotin
Sequence
Synthetic peptide located within the following region: MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTT
Field of Research
Neuroscience
Purification
Affinity Purified
Form
Liquid. Purified antibody supplied in 1x PBS buffer.
Molecular Weight
52kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Applications
WB
NCBI Accession Number
NP_005750
Host or Source
Rabbit
Preservative
Liquid. Purified antibody supplied in 1x PBS buffer.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
207863-AP 100 µL
RHOA (ARH12, ARHA, RHO12, RHOH12, Aplysia ras-related Homolog 12, Oncogene RHO H12, Small GTP Binding Protein RhoA) (AP) discontinued
Sign In for Pricing
View Details 225255-01 50 µL
PRMT2 (ANM2_HUMAN, EC 2.1.1., histone Arginine N Methyltransferase PRMT2, Histone-Arginine N-Methyltransferase PRMT2, HMT 1, HMT1 (hnRNP Methyltransferase S. cerevisiae) like 1, HMT1, HMT1 hnRNP Methyltransferase like 1, hnRNP Methyltransferase (S. cerevisiae) like 1, hnRNP Methyltransferase like 1, Hrmt1l1, MGC111373, PRMT 2, PRMT2 alpha, prmt2, PRMT2 beta, PRMT2 gamma, PRMT2 Protein, PRMT2L2, Protein Arginine Methyltransferase 2, Protein Arginine N Methyltransferase 2, Protein Arginine N-Methyltransferase 2, Zf2) discontinued
Sign In for Pricing
View Details 225255-02 100 µL
PRMT2 (ANM2_HUMAN, EC 2.1.1., histone Arginine N Methyltransferase PRMT2, Histone-Arginine N-Methyltransferase PRMT2, HMT 1, HMT1 (hnRNP Methyltransferase S. cerevisiae) like 1, HMT1, HMT1 hnRNP Methyltransferase like 1, hnRNP Methyltransferase (S. cerevisiae) like 1, hnRNP Methyltransferase like 1, Hrmt1l1, MGC111373, PRMT 2, PRMT2 alpha, prmt2, PRMT2 beta, PRMT2 gamma, PRMT2 Protein, PRMT2L2, Protein Arginine Methyltransferase 2, Protein Arginine N Methyltransferase 2, Protein Arginine N-Methyltransferase 2, Zf2) discontinued
Sign In for Pricing
View Details 039811-ML405 100 µL
PDE7B, CT (PDE7B, cAMP-specific 3',5'-cyclic phosphodiesterase 7B) (MaxLight 405) discontinued
Sign In for Pricing
View Details