Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT8A Rabbit Polyclonal Antibody (HRP)

WNT8A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WNT8D

UniProt

Q9H1J5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_490645

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human INF2 Polyclonal Antibody
HS816014-01 50 µg

Anti-Human INF2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human INF2 Polyclonal Antibody
HS816014-02 100 µg

Anti-Human INF2 Polyclonal Antibody

Sign In for Pricing
View Details
Human Epstein-Barr virus nuclear antigen (EBNA1) antibody, IgG ELISA Kit
MBS706583-01 24 Well (LIMIT 1)

Human Epstein-Barr virus nuclear antigen (EBNA1) antibody, IgG ELISA Kit

Sign In for Pricing
View Details
Human Epstein-Barr virus nuclear antigen (EBNA1) antibody, IgG ELISA Kit
MBS706583-02 48 Well

Human Epstein-Barr virus nuclear antigen (EBNA1) antibody, IgG ELISA Kit

Sign In for Pricing
View Details
Human Epstein-Barr virus nuclear antigen (EBNA1) antibody, IgG ELISA Kit
MBS706583-03 96 Well

Human Epstein-Barr virus nuclear antigen (EBNA1) antibody, IgG ELISA Kit

Sign In for Pricing
View Details
Human Epstein-Barr virus nuclear antigen (EBNA1) antibody, IgG ELISA Kit
MBS706583-04 5x 96 Well

Human Epstein-Barr virus nuclear antigen (EBNA1) antibody, IgG ELISA Kit

Sign In for Pricing
View Details