Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPT1 Rabbit Polyclonal Antibody (HRP)

PPT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PPT, CLN1, INCL

UniProt

P50897

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000301

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM 33 (A Disintegrin and Metalloprotease 33, A Disintegrin and Metalloproteinase Domain 33, Disintegrin and Reprolysin Metalloproteinase Family Protein, Metalloprotease Disintegrin)
A0859-42B 100 µg

ADAM 33 (A Disintegrin and Metalloprotease 33, A Disintegrin and Metalloproteinase Domain 33, Disintegrin and Reprolysin Metalloproteinase Family Protein, Metalloprotease Disintegrin)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cell Adhesion Molecule 1 (CADM1)
MBS2074575-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Cell Adhesion Molecule 1 (CADM1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cell Adhesion Molecule 1 (CADM1)
MBS2074575-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Cell Adhesion Molecule 1 (CADM1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cell Adhesion Molecule 1 (CADM1)
MBS2074575-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Cell Adhesion Molecule 1 (CADM1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cell Adhesion Molecule 1 (CADM1)
MBS2074575-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Cell Adhesion Molecule 1 (CADM1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cell Adhesion Molecule 1 (CADM1)
MBS2074575-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Cell Adhesion Molecule 1 (CADM1)

Sign In for Pricing
View Details