Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRAK4 Rabbit Polyclonal Antibody (HRP)

IRAK4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IPD1, IMD67, REN64, IRAK-4, NY-REN-64

UniProt

Q9NWZ3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001138728

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), Biotin conjugate, 0.1mg/mL
BNCB1237-100 1x 100 µL

P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rBP53-12), CF640R conjugate, 0.1mg/mL
BNC402094-100 1x 100 µL

P53 Tumor Suppressor Protein (rBP53-12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3338), CF594 conjugate, 0.1mg/mL
BNC943338-100 1x 100 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3338), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse FOLR1 Protein (aa 1-231, His Tag)
PKSM040605 100 µg

Recombinant Mouse FOLR1 Protein (aa 1-231, His Tag)

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF488A conjugate, 0.1mg/mL
BNC881448-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polystyrene AM RAM, low loaded
HLL10023.100G 100 g

Polystyrene AM RAM, low loaded

Sign In for Pricing
View Details