Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRAK4 Rabbit Polyclonal Antibody (HRP)

IRAK4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IPD1, IMD67, REN64, IRAK-4, NY-REN-64

UniProt

Q9NWZ3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001138728

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr54 Mouse Gene Knockout Kit (CRISPR)
KN519369 1 Kit

Wdr54 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FXR1 Recombinant Rabbit Monoclonal Antibody [PSH01-35]
HA721669 100 µL

FXR1 Recombinant Rabbit Monoclonal Antibody [PSH01-35]

Sign In for Pricing
View Details
Annexin A11 (ANXA11) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C6]
TA500950BM 100 µL

Annexin A11 (ANXA11) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C6]

Sign In for Pricing
View Details
PDE1A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H4]
TA803635BM 100 µL

PDE1A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H4]

Sign In for Pricing
View Details
Heme oxygenase 2 (HMOX2) Human Gene Knockout Kit (CRISPR)
KN401777 1 Kit

Heme oxygenase 2 (HMOX2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PISD Mouse Monoclonal Antibody [Clone ID: OTI2H1]
CF807331 100 µg

PISD Mouse Monoclonal Antibody [Clone ID: OTI2H1]

Sign In for Pricing
View Details