Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Git1 Rabbit Polyclonal Antibody (FITC)

Git1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9Z272

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Git1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKE

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_114002

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine WD repeat-containing protein 18, WDR18 ELISA KIT
ELI-16959b 96 Tests

Bovine WD repeat-containing protein 18, WDR18 ELISA KIT

Sign In for Pricing
View Details
ZNF718 3'UTR Luciferase Stable Cell Line
TU029397 1.0 mL

ZNF718 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monkey Cytochrome P450 4Z1 (CYP4Z1) ELISA kit
GTR10375262 96 Well

Monkey Cytochrome P450 4Z1 (CYP4Z1) ELISA kit

Sign In for Pricing
View Details
GRK3, CT (G-Protein Coupled Receptor Kinase 3, Beta-adrenergic Receptor Kinase 2, ADRBK2, Beta-ARK-2, BARK2) (Biotin)
MBS6479003-01 0.2 mL

GRK3, CT (G-Protein Coupled Receptor Kinase 3, Beta-adrenergic Receptor Kinase 2, ADRBK2, Beta-ARK-2, BARK2) (Biotin)

Sign In for Pricing
View Details
GRK3, CT (G-Protein Coupled Receptor Kinase 3, Beta-adrenergic Receptor Kinase 2, ADRBK2, Beta-ARK-2, BARK2) (Biotin)
MBS6479003-02 5x 0.2 mL

GRK3, CT (G-Protein Coupled Receptor Kinase 3, Beta-adrenergic Receptor Kinase 2, ADRBK2, Beta-ARK-2, BARK2) (Biotin)

Sign In for Pricing
View Details
LOC100361672 3'UTR Luciferase Stable Cell Line
TU208046 1.0 mL

LOC100361672 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details