Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP153 Rabbit Polyclonal Antibody (FITC)

NUP153 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

N153, HNUP153

UniProt

P49790

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQ

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

162kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005115

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic Anhydrase XI (CA11) Human Gene Knockout Kit (CRISPR)
KN401187 1 Kit

Carbonic Anhydrase XI (CA11) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF594 conjugate, 0.1mg/mL
BNC940859-500 1x 500 µL

Human Kappa Light Chain (Kap-56), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Ankrd53 activation kit by CRISPRa
GA210165 1 Kit

Mouse Ankrd53 activation kit by CRISPRa

Sign In for Pricing
View Details
alpha Actinin 4 (ACTN4) Human Gene Knockout Kit (CRISPR)
KN402873 1 Kit

alpha Actinin 4 (ACTN4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTCH1 Rabbit Polyclonal Antibody
TA372983 100 µL

PTCH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AKT1S1 Rabbit Monoclonal Antibody [Clone ID: 23GB3855]
TA425108 100 µL

AKT1S1 Rabbit Monoclonal Antibody [Clone ID: 23GB3855]

Sign In for Pricing
View Details