Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP153 Rabbit Polyclonal Antibody (HRP)

NUP153 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N153, HNUP153

UniProt

P49790

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQ

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

162kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005115

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFRD1 (NM_001550) Human Tagged ORF Clone
RG217538 10 µg

IFRD1 (NM_001550) Human Tagged ORF Clone

Sign In for Pricing
View Details
TP53AIP1 Antibody : FITC (OAAF03077-FITC)
OAAF03077-100UG-FITC 100 µg

TP53AIP1 Antibody : FITC (OAAF03077-FITC)

Sign In for Pricing
View Details
Canine PDGF-BB Recombinant Protein
RP1322D-01 5 µg

Canine PDGF-BB Recombinant Protein

Sign In for Pricing
View Details
Canine PDGF-BB Recombinant Protein
RP1322D-02 25 µg

Canine PDGF-BB Recombinant Protein

Sign In for Pricing
View Details
Canine PDGF-BB Recombinant Protein
RP1322D-03 100 µg

Canine PDGF-BB Recombinant Protein

Sign In for Pricing
View Details
Mouse Il22ra1 qPCR Primer Pair
QM59450S 200 Tests

Mouse Il22ra1 qPCR Primer Pair

Sign In for Pricing
View Details