Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAF1 Rabbit Polyclonal Antibody (Biotin)

PAF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PD2, F23149_1

UniProt

Q8N7H5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_061961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDA Protein Vector (Mouse) (pPM-C-HA)
PV174424 500 ng

EDA Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
DDX58 Polyclonal Antibody, Biotin Conjugated
bs-0993R-Biotin-01 20 µL

DDX58 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
DDX58 Polyclonal Antibody, Biotin Conjugated
bs-0993R-Biotin-02 100 µL

DDX58 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
ALS2CR8 (CARF, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 8 Protein, Calcium-response Factor, Testis Development Protein NYD-SP24, DKFZp667N246, FLJ12675, FLJ21579)
123271 100 µg

ALS2CR8 (CARF, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 8 Protein, Calcium-response Factor, Testis Development Protein NYD-SP24, DKFZp667N246, FLJ12675, FLJ21579)

Sign In for Pricing
View Details
Simport Urisafe Container 3L
CON2060 40 / PCK

Simport Urisafe Container 3L

Sign In for Pricing
View Details
Cdh2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K5033505 3x 1.0 µg

Cdh2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details