Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMA4D Rabbit Polyclonal Antibody (Biotin)

SEMA4D Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A8, GR3, BB18, CD100, COLL4, SEMAJ, coll-4, C9orf164, M-sema-G

UniProt

Q92854

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001135759

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PDLIM4 Antibody Picoband® Fluoro550 Conjugated
A09573-2-Fluoro550 100 µg/Vial

Anti-PDLIM4 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
MBD6 Human shRNA Plasmid Kit (Locus ID 114785)
TL303327 1 Kit

MBD6 Human shRNA Plasmid Kit (Locus ID 114785)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YJR124C Polyclonal Antibody
MBS7159316 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YJR124C Polyclonal Antibody

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044187-01 0.1 mL

FITC-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044187-02 0.2 mL

FITC-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044187-03 0.5 mL

FITC-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details