Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTNR1A Rabbit Polyclonal Antibody (HRP)

MTNR1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MT1, MEL-1A-R

UniProt

P48039

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005949

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taq Mix (2x)
P2012 5x 1 mL

Taq Mix (2x)

Sign In for Pricing
View Details
RMND5A Polyclonal Antibody
A55347-050 50 µL

RMND5A Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 1 Receptor Type I (Interleukin Receptor 1, IL-1R-1, IL1R1, IL-1RT1, IL1RT1, Interleukin 1 Receptor alpha Type 1, IL-1R alpha, IL1RA, Antigen CD121a, CD121A, CD121a Antigen, D2S1473, IL-1R1, IL1 Inhibitor, P80)(APC)
MBS6507791-01 100 Tests

Interleukin 1 Receptor Type I (Interleukin Receptor 1, IL-1R-1, IL1R1, IL-1RT1, IL1RT1, Interleukin 1 Receptor alpha Type 1, IL-1R alpha, IL1RA, Antigen CD121a, CD121A, CD121a Antigen, D2S1473, IL-1R1, IL1 Inhibitor, P80)(APC)

Sign In for Pricing
View Details
Interleukin 1 Receptor Type I (Interleukin Receptor 1, IL-1R-1, IL1R1, IL-1RT1, IL1RT1, Interleukin 1 Receptor alpha Type 1, IL-1R alpha, IL1RA, Antigen CD121a, CD121A, CD121a Antigen, D2S1473, IL-1R1, IL1 Inhibitor, P80)(APC)
MBS6507791-02 5x 100 Tests

Interleukin 1 Receptor Type I (Interleukin Receptor 1, IL-1R-1, IL1R1, IL-1RT1, IL1RT1, Interleukin 1 Receptor alpha Type 1, IL-1R alpha, IL1RA, Antigen CD121a, CD121A, CD121a Antigen, D2S1473, IL-1R1, IL1 Inhibitor, P80)(APC)

Sign In for Pricing
View Details
ZDHHC4 Rabbit pAb
E45R24134N-100 100 µL

ZDHHC4 Rabbit pAb

Sign In for Pricing
View Details
Rabbit anti-Drosophila yakuba (Fruit fly) CUE Polyclonal Antibody
MBS7170569 Inquire

Rabbit anti-Drosophila yakuba (Fruit fly) CUE Polyclonal Antibody

Sign In for Pricing
View Details