Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arl6ip1 Rabbit Polyclonal Antibody (HRP)

Arl6ip1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q7TMZ5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Arl6ip1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_942032

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transformer 2 Beta (TRA2b, SRFS10, Htra2-beta, TRA2-BETA, TRA2B, Splicing Factor, Arginine/Serine-Rich 10)
142584 200 µL

Transformer 2 Beta (TRA2b, SRFS10, Htra2-beta, TRA2-BETA, TRA2B, Splicing Factor, Arginine/Serine-Rich 10)

Sign In for Pricing
View Details
CALML4 Double Nickase Plasmid (m)
sc-429139-NIC 20 µg

CALML4 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Lentiviral human HOXC6 shRNA (UAS) - Lentiviral human HOXC6 shRNA (UAS, GFP) (100)
GTR15141117 1 Vial

Lentiviral human HOXC6 shRNA (UAS) - Lentiviral human HOXC6 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
4-(4-Chlorophenyl)phenylacetic acid
TRC-C428210-250MG 250 mg

4-(4-Chlorophenyl)phenylacetic acid

Sign In for Pricing
View Details
Rat Monoclonal ErbB2/Her2 Antibody (666521) [Janelia Fluor 585]
FAB6744JF585 0.1 mL

Rat Monoclonal ErbB2/Her2 Antibody (666521) [Janelia Fluor 585]

Sign In for Pricing
View Details
Recombinant Human Mucin 7, Secreted (MUC7)
RPU55719-01 50 µg

Recombinant Human Mucin 7, Secreted (MUC7)

Sign In for Pricing
View Details