Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2f6 Rabbit Polyclonal Antibody (FITC)

E2f6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat E2f6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001094187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF2 Blocking Peptide
MBS9625523-01 1 mg

TRAF2 Blocking Peptide

Sign In for Pricing
View Details
TRAF2 Blocking Peptide
MBS9625523-02 5x 1 mg

TRAF2 Blocking Peptide

Sign In for Pricing
View Details
BRSK1 (NM_032430) Human Over-expression Lysate
LS084446-100ug 100 µg

BRSK1 (NM_032430) Human Over-expression Lysate

Sign In for Pricing
View Details
Hsa-miR-1202 miRNA Antagomir
CIJ0741-01 10 nmol

Hsa-miR-1202 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-1202 miRNA Antagomir
CIJ0741-02 20 nmol

Hsa-miR-1202 miRNA Antagomir

Sign In for Pricing
View Details
NR1H3, Control Peptide (Oxysterols Receptor LXR-alpha, Liver X Receptor alpha, Nuclear Receptor Subfamily 1 Group H Member 3, LXRA)
147503 100 µg

NR1H3, Control Peptide (Oxysterols Receptor LXR-alpha, Liver X Receptor alpha, Nuclear Receptor Subfamily 1 Group H Member 3, LXRA)

Sign In for Pricing
View Details